PDB entry 2jc5

View 2jc5 on RCSB PDB site
Description: apurinic apyrimidinic (ap) endonuclease (nape) from neisseria meningitidis
Class: hydrolase
Keywords: hydrolase, neisseria meningitidis, repair phosphodiesterase, DNA repair, exonuclease, endonuclease
Deposited on 2006-12-19, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.123
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease
    Species: NEISSERIA MENINGITIDIS [TaxId:487]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jc5a_
  • Heterogens: MG, BCN, GOL, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jc5A (A:)
    mlkiisanvngirsaykkgfyeyiaasgadivcvqelkaqeadlsadmknphgmhghwhc
    aekrgysgvavyskrkpdnvqigmgieefdregrfvrcdfgrlsvislylpsgssaeerq
    qvkyrfldafypmleamknegrdivvcgdwniahqnidlknwkgnqknsgflpeerewig
    kvihklgwtdmwrtlypdvpgytwwsnrgqayakdvgwridyqmvtpelaakavsahvyk
    dekfsdhaplvveydyaae