PDB entry 2jc4

View 2jc4 on RCSB PDB site
Description: 3'-5' exonuclease (nexo) from neisseria meningitidis
Class: hydrolase
Keywords: hydrolase, neisseria meningitidis, repair phosphodiesterase, DNA repair, exonuclease, endonuclease
Deposited on 2006-12-19, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.152
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exodeoxyribonuclease III
    Species: NEISSERIA MENINGITIDIS [TaxId:487]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jc4a_
  • Heterogens: MG, NA, 1PE, ACT, 2HP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jc4A (A:)
    mkittwnvnslnvrlpqvqnlladnppdilvlqelkldqdkfpaaalqmmgwhcvwsgqk
    tyngvaivsrsvpqdvhfglpalpddpqrrviaatvsgvrvinvycvngealdspkfkyk
    eqwfaaltefvrdemtrhgklvllgdfniapadadcydpekwhekihcssverqwfqnll
    dlgltdslrqvhpegafytwfdyrgamfqrklglridhilvspamaaalkdvrvdletra
    lerpsdhapvtaefdw