PDB entry 2jc3

View 2jc3 on RCSB PDB site
Description: structure of o-acetylserine sulfhydrylase b from salmonella typhimurium
Class: transferase
Keywords: transferase, sulfhydrylase, pyridoxal phosphate, vitamin b6 dependent enzyme, cysteine biosynthesis, amino-acid biosynthesis
Deposited on 2006-12-19, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3a_
  • Chain 'B':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3b_
  • Chain 'C':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3c_
  • Chain 'D':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3d_
  • Chain 'E':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3e_
  • Chain 'F':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3f_
  • Chain 'G':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3g_
  • Chain 'H':
    Compound: o-acetylserine sulfhydrylase b
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29848 (0-End)
      • conflict (18)
    Domains in SCOPe 2.07: d2jc3h_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jc3A (A:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3A (A:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jc3B (B:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3B (B:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jc3C (C:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3C (C:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jc3D (D:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3D (D:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jc3E (E:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3E (E:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jc3F (F:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3F (F:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2jc3G (G:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3G (G:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2jc3H (H:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfgeehfsqg
    agi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jc3H (H:)
    mntleqtigntplvklqrigpdngseiwvklegnnpagsvkdraalsmiveaekrgeikp
    gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
    gardlalamsergegklldqfnnpdnpyahytttgpeiwrqtsgrithfvssmgttgtit
    gvsrflreqekpvtivglqpeegssipgirrwpaeympgifnaslvdevldihqndaent
    mrelavregifcgvssggavagalrvaratpgaivvaiicdrgdrylstgvfge