PDB entry 2jbl

View 2jbl on RCSB PDB site
Description: photosynthetic reaction center from blastochloris viridis
Class: electron transport
Keywords: chromophore, formylation, chlorophyll, lipoprotein, stigmatellin, metal-binding, transmembrane, iron, heme, membrane, transport, magnesium, photosynthesis, reaction center, electron transport, bacteriochlorophyll, photosynthetic reaction center
Deposited on 2006-12-08, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Photosynthetic reaction center cytochrome c subunit
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jblc_
  • Chain 'H':
    Compound: reaction center protein h chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jblh1, d2jblh2
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jbll_
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: BLASTOCHLORIS VIRIDIS [TaxId:1079]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jblm_
  • Heterogens: HEM, LDA, SO4, BCB, BPB, SMA, FE, MQ7, NS5, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jblC (C:)
    mkqlivnsvatvalaslvagcfepppatttqtgfrglsmgevlhpatvkakkerdaqypp
    alaavkaegppvsqvyknvkvlgnlteaeflrtmtaitewvspqegctychdennlasea
    kypyvvarrmlemtraintnwtqhvaqtgvtcytchrgtplppyvryleptlplnnretp
    thvervetrsgyvvrlakytaysalnydpftmflandkrqvrvvpqtalplvgvsrgker
    rplsdayatfalmmsisdslgtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmn
    ylaplnaslpasrlgrqgeapqadcrtchqgvtkplfgasrlkdypelgpikaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jblC (C:)
    cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
    vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
    wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
    aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
    gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
    pqadcrtchqgvtkplfgasrlkdypelgpik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jblH (H:)
    myhgalaqhldiaqlvwyaqwlviwtvvllylrredrregyplveplglvklapedgqvy
    elpypktfvlphggtvtvprrrpetrelklaqtdgfegaplqptgnplvdavgpasyaer
    aevvdatvdgkakivplrvatdfsiaegdvdprglpvvaadgveagtvtdlwvdrsehyf
    rylelsvagsartaliplgfcdvkkdkivvtsilseqfanvprlqsrdqitlreedkvsa
    yyaggllyatperaesll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jblL (L:)
    allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
    pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
    fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
    fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
    fltgafgtiasgpfwtrgwpewwgwwldipfws
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jblM (M:)
    adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
    fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
    tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
    idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
    taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
    aapdypaylpatpdpaslpgapk