PDB entry 2jbj

View 2jbj on RCSB PDB site
Description: membrane-bound glutamate carboxypeptidase II (gcpii) in complex with 2-pmpa (2-phosphonomethyl-pentanedioic acid)
Class: hydrolase
Keywords: multifunctional enzyme, neurodegenerative disease, glycoprotein, metal-binding, signal-anchor, hydrolase, naaladase, dipeptidase, polymorphism, zinc, psma, antigen, membrane, protease, peptidase, transmembrane, metal- binding, metalloprotease, prostate cancer, carboxypeptidase, alternative splicing
Deposited on 2006-12-07, released 2006-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.193
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate carboxypeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jbja1, d2jbja2, d2jbja3
  • Heterogens: ZN, CA, CL, NAG, G88, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jbjA (A:)
    kssneatnitpkhnmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkef
    gldsvelahydvllsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsa
    fspqgmpegdlvyvnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagak
    gvilysdpadyfapgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgi
    aeavglpsipvhpigyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvk
    mhihstnevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfg
    tlkkegwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlr
    vdctplmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfev
    ffqrlgiasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggm
    vfelansivlpfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteia
    skfserlqdfdksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyage
    sfpgiydalfdieskvdpskawgevkrqiyvaaftvqaaaetlseva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jbjA (A:)
    nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
    lsypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvy
    vnyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfa
    pgvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhp
    igyydaqkllekmggsappdsswrgslkvpynvgpgftfstqkvkmhihstnevtriynv
    igtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkkegwrprrtilf
    aswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctplmyslvhnlt
    kelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrlgiasgraryt
    knfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfelansivlpfdcrdyavv
    lrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdfdksnpivlrm
    mndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdieskvdpsk
    awgevkrqiyvaaftvqaaaetlseva