PDB entry 2jba

View 2jba on RCSB PDB site
Description: phob response regulator receiver domain constitutively-active double mutant d53a and y102c.
Class: transcription
Keywords: transcription factor, sensory transduction, phosphate regulation, transcription regulation, activator, transport, DNA-binding, constitutively-active mutant, two-component regulatory system, gene regulation, phosphate transport, activation of the pho regulon, transcription, phosphorylation, alpha/beta doubly woun fold
Deposited on 2006-12-05, released 2007-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.189
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AFJ5
      • engineered mutation (52)
      • conflict (68)
      • engineered mutation (101)
    Domains in SCOPe 2.06: d2jbaa_
  • Chain 'B':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AFJ5
      • engineered mutation (52)
      • engineered mutation (101)
    Domains in SCOPe 2.06: d2jbab_
  • Heterogens: NA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jbaA (A:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillawmlpggs
    giqfikhlrresmtrdipvvmltargeeedrvrgletgaddcitkpfspkelvarikavm
    rrispma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jbaA (A:)
    arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillawmlpggsg
    iqfikhlrresmtrdipvvmltargeeedrvrgletgaddcitkpfspkelvarikavmr
    rispm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jbaB (B:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillawmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddcitkpfspkelvarikavm
    rrispma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jbaB (B:)
    arrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlillawmlpggsg
    iqfikhlkresmtrdipvvmltargeeedrvrgletgaddcitkpfspkelvarikavmr
    r