PDB entry 2jav

View 2jav on RCSB PDB site
Description: human kinase with pyrrole-indolinone ligand
Class: transferase
Keywords: phosphorylation, nucleotide-binding, ATP-binding, transferase, coiled coil, polymorphism, cell division, metal-binding, nuclear protein, alternative splicing, serine/threonine-protein kinase, serine/threonine protein kinase, kinase, meiosis, mitosis, magnesium, cell cycle
Deposited on 2006-11-30, released 2006-12-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-04, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2java1
  • Heterogens: 5Z5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2javA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2javA (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
    khpnivryydriidtlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalke
    chrrsdlkpanvfldgkqnvklgdfglarilgtpyymspeqmnrmsyneksdiwslgcll
    yelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeil
    enplilehhhhhh