PDB entry 2jav

View 2jav on RCSB PDB site
Description: human kinase with pyrrole-indolinone ligand
Class: transferase
Keywords: transferase, phosphorylation, nucleotide-binding, ATP-binding, cell division, metal-binding, nuclear protein, serine/threonine-protein kinase, serine/threonine protein kinase, kinase, meiosis, mitosis, magnesium, cell cycle
Deposited on 2006-11-30, released 2006-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase nek2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51955 (Start-270)
    • PDB 2JAV (271-278)
    Domains in SCOPe 2.07: d2java1, d2java2
  • Heterogens: 5Z5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2javA (A:)
    mpsraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllr
    elkhpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtql
    tlalkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfakafvgtp
    yymspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyry
    sdelneiitrmlnlkdyhrpsveeilenplilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2javA (A:)
    sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
    khpnivryydriidtlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalke
    chrrsdlkpanvfldgkqnvklgdfglarilgtpyymspeqmnrmsyneksdiwslgcll
    yelcalmppftafsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeil
    enplilehhhhhh