PDB entry 2jas

View 2jas on RCSB PDB site
Description: structure of deoxyadenosine kinase from m.mycoides with bound datp
Class: transferase
Keywords: kinase, transferase
Deposited on 2006-11-30, released 2007-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.235
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jasa_
  • Chain 'B':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jasb_
  • Chain 'C':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93IG4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2jasc1, d2jasc2
  • Chain 'D':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jasd_
  • Chain 'E':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jase_
  • Chain 'F':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93IG4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d2jasf1, d2jasf2
  • Heterogens: DTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jasA (A:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkip
    enklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpff
    vvdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jasA (A:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenklsfd
    iviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeld
    vktqielimnklns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jasB (B:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkip
    enklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpff
    vvdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jasB (B:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlsfdi
    viylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldv
    ktqielimnklns
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2jasC (C:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkip
    enklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpff
    vvdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jasC (C:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenllsf
    diviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdael
    dvktqielimnklns
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2jasD (D:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkip
    enklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpff
    vvdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jasD (D:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlfdiv
    iylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldvk
    tqielimnklns
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2jasE (E:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkip
    enklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpff
    vvdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jasE (E:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenllsfd
    iviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeld
    vktqielimnklns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2jasF (F:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkip
    enklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpff
    vvdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jasF (F:)
    hmkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlt
    arskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlensfdi
    viylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldv
    ktqielimnklns