PDB entry 2jaq

View 2jaq on RCSB PDB site
Description: structure of deoxyadenosine kinase from m. mycoides with bound dctp
Class: transferase
Keywords: kinase, transferase, deoxyribonucleoside kinase
Deposited on 2006-11-30, released 2007-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jaqa_
  • Chain 'B':
    Compound: deoxyguanosine kinase
    Species: MYCOPLASMA MYCOIDES SUBSP. MYCOIDES SC [TaxId:44101]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2jaqb_
  • Heterogens: DCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2jaqA (A:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkipe
    nklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffv
    vdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jaqA (A:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenklsfdiviylr
    vstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldvktqie
    limnklnsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2jaqB (B:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkqaknleniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlenlkipe
    nklsfdiviylrvstktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffv
    vdaeldvktqielimnklnsiknpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2jaqB (B:)
    mkiaifgtvgagkstisaeiskklgyeifkepveenpyfeqyykdlkktvfkmqiymlta
    rskqlkniifdrtlledpifmkvnydlnnvdqtdyntyidfynnvvlklsfdiviylrvs
    tktaisrikkrgrseelligeeywetlnknyeefykqnvydfpffvvdaeldvktqieli
    mnklnsi