PDB entry 2ja1

View 2ja1 on RCSB PDB site
Description: thymidine kinase from b. cereus with ttp bound as phosphate donor.
Class: transferase
Keywords: tk1, dnk, lasso, kinase, transferase, phosphate donor, deoxyribonucleoside kinase
Deposited on 2006-11-17, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidine kinase
    Species: BACILLUS CEREUS [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JA1 (0-1)
    • Uniprot Q0H9H6 (2-End)
    Domains in SCOPe 2.07: d2ja1a1, d2ja1a2
  • Heterogens: ZN, TTP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ja1A (A:)
    gsmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcidnryseedvvsh
    nglkvkavpvsaskdifehiteeldviaidevqffdgdivevvqvlanrgyrvivagldq
    dfrglpfgqvpqlmaiaehvtklqavcsvcgspasrtqrlidgepaafddpiilvgases
    yeprcrhchavpankdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ja1A (A:)
    gsmylinqngwievicgsmfsgkseelirrvrrtqfakqhaivfkpcidnryseedvvsh
    nglkvkavpvsaskdifehiteeldviaidevqffdgdivevvqvlanrgyrvivagldq
    dfrglpfgqvpqlmaiaehvtklqavcsvcgspasrtqrlidgepaafddpiilvgases
    yeprcrhchavpa