PDB entry 2j9x

View 2j9x on RCSB PDB site
Description: tryptophan synthase in complex with gp, alpha-d,l-glycerol-phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a-a)
Class: lyase
Keywords: aromatic amino acid biosynthesis, tryptophan biosynthesis, crbon- oxygen lyase, amino-acid biosynthesis, lyase, allosteric enzyme, pyridoxal phosphate, synthase
Deposited on 2006-11-16, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j9xa_
  • Chain 'B':
    Compound: tryptophan synthase beta chain
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j9xb_
  • Heterogens: G3P, P1T, CS, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j9xA (A:)
    meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
    gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
    vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
    gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
    ieknlaspkqmlaelrsfvsamkaasra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9xA (A:)
    eryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdpladg
    ptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceqv
    gvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrsg
    vtgaenrglhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiiekn
    laspkqmlaelrsfvsamkaasra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j9xB (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkargei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9xB (B:)
    ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
    cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
    asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
    etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
    adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
    agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
    mreqpekeqllvvnlsgrgdkdiftvhdilkarge