PDB entry 2j9f

View 2j9f on RCSB PDB site
Description: human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, mitochondrion, thiamine pyrophosphate, maple syrup urine disease, transit peptide, phosphorylation, disease mutation, metal-binding, multi-enzyme complex
Deposited on 2006-11-07, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.171
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j9fa_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21953 (Start-341)
      • expression tag (342)
    Domains in SCOPe 2.07: d2j9fb1, d2j9fb2, d2j9fb3
  • Chain 'C':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j9fc_
  • Chain 'D':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21953 (Start-341)
      • expression tag (342)
    Domains in SCOPe 2.07: d2j9fd1, d2j9fd2, d2j9fd3
  • Heterogens: MN, K, THV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j9fA (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssay
    rpvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9fA (A:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssaydhpis
    rlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrk
    qqeslarhlqtygehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j9fB (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminygghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9fB (B:)
    eygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntp
    lceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltir
    spwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkil
    yraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevid
    lrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleapisrvcgy
    dtpfphifepfyipdkwkcydalrkminyg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j9fC (C:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssay
    rpvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9fC (C:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssaydhpis
    rlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrk
    qqeslarhlqtygehypldhfdk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j9fD (D:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminygghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j9fD (D:)
    eygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntp
    lceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltir
    spwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkil
    yraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevid
    lrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleapisrvcgy
    dtpfphifepfyipdkwkcydalrkminyg