PDB entry 2j8x

View 2j8x on RCSB PDB site
Description: epstein-barr virus uracil-DNA glycosylase in complex with ugi from pbs-2
Class: hydrolase/inhibitor complex
Keywords: ebv, DNA repair, lytic protein, epstein-barr virus, uracil-DNA glycosylase,hydrolase, uracil-DNA glycosylase inhibitor, hydrolase/inhibitor complex
Deposited on 2006-10-31, released 2006-12-13
The last revision prior to the SCOP 1.75 freeze date was dated 2007-02-06, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: EPSTEIN-BARR VIRUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j8xa1
  • Chain 'B':
    Compound: uracil-DNA glycosylase inhibitor
    Species: BACTERIOPHAGE PBS2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j8xb1
  • Chain 'C':
    Compound: uracil-DNA glycosylase
    Species: EPSTEIN-BARR VIRUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j8xc1
  • Chain 'D':
    Compound: uracil-DNA glycosylase inhibitor
    Species: BACTERIOPHAGE PBS2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j8xd1
  • Heterogens: URE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j8xA (A:)
    genlllpdlwldflqlspifqrklaaviacvrrlrtqatvypeedmcmawarfcdpsdik
    vvilgqdpyhggqanglafsvaygfpvppslrniyaelhrslpefsppdhgcldawasqg
    vlllntiltvqkgkpgshadigwawftdhvisllserlkacvfmlwgakagdkaslinsk
    khlvltsqhpsplaqnstrksaqqkflgnnhfvlannflrekglgeidwrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8xA (A:)
    enlllpdlwldflqlspifqrklaaviacvrrlrtqatvypeedmcmawarfcdpsdikv
    vilgqdpyhggqanglafsvaygfpvppslrniyaelhrslpefsppdhgcldawasqgv
    lllntiltvqkgkpgshadigwawftdhvisllserlkacvfmlwgakagdkaslinskk
    hlvltsqhpsplaqnstrksaqqkflgnnhfvlannflrekglgeidwrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j8xB (B:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8xB (B:)
    tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
    apeykpwalviqdsngenkikml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j8xC (C:)
    genlllpdlwldflqlspifqrklaaviacvrrlrtqatvypeedmcmawarfcdpsdik
    vvilgqdpyhggqanglafsvaygfpvppslrniyaelhrslpefsppdhgcldawasqg
    vlllntiltvqkgkpgshadigwawftdhvisllserlkacvfmlwgakagdkaslinsk
    khlvltsqhpsplaqnstrksaqqkflgnnhfvlannflrekglgeidwrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8xC (C:)
    nlllpdlwldflqlspifqrklaaviacvrrlrtqatvypeedmcmawarfcdpsdikvv
    ilgqdpyhggqanglafsvaygfpvppslrniyaelhrslpefsppdhgcldawasqgvl
    llntiltvqkgkpgshadigwawftdhvisllserlkacvfmlwgakagdkaslinskkh
    lvltsqhpsplaqnstrksaqqkflgnnhfvlannflrekglgeidwrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j8xD (D:)
    mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
    dapeykpwalviqdsngenkikml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j8xD (D:)
    lsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsdap
    eykpwalviqdsngenkikml