PDB entry 2j8e

View 2j8e on RCSB PDB site
Description: chey-phob emr chimera to study dephosphorylation of response regulators
Class: transferase
Keywords: transferase, bef3, magnesium, chemotaxis, acetylation, flagellar rotation, sensory transduction, metal-binding, activated chey, receiver domain, two-component signal transduction, two-component regulatory system, transferase phosphorylation, signaling protein, response regulator
Deposited on 2006-10-24, released 2007-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE67 (0-127)
    • engineered mutation (12)
    • engineered mutation (57)
    • engineered mutation (87)
  Domains in SCOPe 2.06: d2j8ea_
• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE67 (0-127)
    • engineered mutation (12)
    • engineered mutation (57)
    • engineered mutation (87)
  Domains in SCOPe 2.06: d2j8eb_
• Heterogens: BEF, MN, GOL, NH4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j8eA (A:)
  adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
  nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j8eB (B:)
  adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
  nmdglellktiradgamsalpvlmvtarakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm