PDB entry 2j8d

View 2j8d on RCSB PDB site
Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 8 in the charge-separated state
Class: electron transport
Keywords: bacteriochlorophyll, phosphatidylcholine, chlorophyll, cardiolipin, metal-binding, transmembrane, glucosylgalactosyl diacylglycerol, proton translocation pathways, photosynthesis, reaction center, electron transport, iron, membrane, transport, magnesium, chromophore, binding positions of the secondary quinone qb
Deposited on 2006-10-24, released 2007-07-03
The last revision prior to the SCOP 1.75 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.19779
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: reaction center protein h chain
    Species: RHODOBACTER SPHAEROIDES
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: reaction center protein l chain
    Species: RHODOBACTER SPHAEROIDES
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j8dl1
  • Chain 'M':
    Compound: reaction center protein m chain
    Species: RHODOBACTER SPHAEROIDES
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j8dm1
  • Heterogens: PO4, FE, BCL, LDA, BPH, U10, HTO, SPO, CDL, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j8dL (L:)
    allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
    pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
    fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
    ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
    vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j8dM (M:)
    aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
    fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
    fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
    shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
    rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
    hgmapln