PDB entry 2j7y

View 2j7y on RCSB PDB site
Description: structure of 17-epiestriol-bound estrogen receptor beta lbd in complex with lxxll motif from ncoa5
Class: transcription
Keywords: receptor, activator, repressor, zinc-finger, nuclear receptor, transcription factor, nuclear protein, phosphorylation, steroid-binding, coactivator, corepressor, DNA-binding, glycoprotein, transcription regulation, transcription, metal-binding, lipid-binding
Deposited on 2006-10-17, released 2006-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j7ya_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 5
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: E3O, EDO, BCT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j7yA (A:)
    vkelllstlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwak
    kipgfvelslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegil
    eifdmllattsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavt
    dalvwviaksgissqqqsvrlanllmllshvrhisnkgmehllsmkcknvvpvydlllem
    lnahtlrgykssisg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j7yA (A:)
    tlspeqlvltlleaeppnvlvsfteasmmmsltkladkelvhmigwakkipgfvelslld
    qvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmllattsr
    frelklqhkeylcvkamillnssmyplaessrklthllnavtdalvwviaksgissqqqs
    vrlanllmllshvrhisnkgmehllsmkcknvvpvydlllemlnah
    

  • Chain 'B':
    No sequence available.