PDB entry 2j72

View 2j72 on RCSB PDB site
Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
Class: hydrolase
Keywords: carbohydrate-binding module, hydrolase, glycosidase, maltotetraose, beta- sandwich fold, alpha-glucan binding
Deposited on 2006-10-05, released 2006-10-17
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-29, with a file datestamp of 2008-04-25.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.16817
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pullulanase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33840 (Start-102)
      • conflict (1)
    Domains in SCOP 1.75: d2j72a1
  • Chain 'B':
    Compound: pullulanase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33840 (0-102)
      • conflict (1)
    Domains in SCOP 1.75: d2j72b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j72A (A:)
    ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
    giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j72A (A:)
    tettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkvg
    iivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j72B (B:)
    ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
    giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp