PDB entry 2j71

View 2j71 on RCSB PDB site
Description: alpha-glucan recognition by a family 41 carbohydrate-binding module from thermotoga maritima pullulanase pula
Class: hydrolase
Keywords: hydrolase, alpha-glucan binding, carbohydrate-binding module, hydrolase, glycosidase, beta-sandwich fold
Deposited on 2006-10-05, released 2006-10-17
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-29, with a file datestamp of 2008-04-25.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.2071
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pullulanase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33840 (Start-102)
      • conflict (1)
    Domains in SCOP 1.75: d2j71a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j71A (A:)
    ftettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkv
    giivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j71A (A:)
    tettivvhyhrydgkydgwnlwiwpvepvsqegkayqftgeddfgkvavvklpmdltkvg
    iivrlnewqakdvakdrfieikdgkaevwilqgveeifyekp