PDB entry 2j6e

View 2j6e on RCSB PDB site
Description: crystal structure of an autoimmune complex between a human igm rheumatoid factor and igg1 fc reveals a novel fc epitope and evidence for affinity maturation
Class: immune system
Keywords: autoimmune complex human igm rheumatoid factor igg1-fc, immunoglobulin c region, membrane, glycoprotein, transmembrane, hypothetical protein, immune system, immunoglobulin domain
Deposited on 2006-09-28, released 2007-04-10
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (54)
    Domains in SCOP 1.73: d2j6ea1, d2j6ea2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (54)
    Domains in SCOP 1.73: d2j6eb1, d2j6eb2
  • Chain 'H':
    Compound: igm
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J6E (Start-227)
  • Chain 'I':
    Compound: igm
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J6E (Start-227)
  • Chain 'L':
    Compound: igm
    Species: HOMO SAPIENS
    Gene:
  • Chain 'M':
    Compound: igm
    Species: HOMO SAPIENS
    Gene:
  • Heterogens: CD, ZN, CAC, ACT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j6eA (A:)
    epkscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekt
    iskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j6eB (B:)
    epkscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvsheepevkf
    nwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekt
    iskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttp
    pvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j6eB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvsheepevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslslspg
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.