PDB entry 2j5k

View 2j5k on RCSB PDB site
Description: 2.0 a resolution structure of the wild type malate dehydrogenase from haloarcula marismortui (radiation damage series)
Class: oxidoreductase
Keywords: nad, halophile, oxidoreductase, radiation damage, malate dehydrogenase, tricarboxylic acid cycle
Deposited on 2006-09-18, released 2006-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2252
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j5ka1, d2j5ka2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j5kb1, d2j5kb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j5kc1, d2j5kc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: HALOARCULA MARISMORTUI [TaxId:2238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j5kd1, d2j5kd2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5kA (A:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5kA (A:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j5kB (B:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5kB (B:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
    nrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfsk
    vrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdtgevlp
    asvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j5kC (C:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5kC (C:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
    pvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqv
    pvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdt
    gevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqyd
    kis
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j5kD (D:)
    mtkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntr
    vrqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyisltts
    npvdllnrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaq
    vpvfskvrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhd
    tgevlpasvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqy
    dkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5kD (D:)
    tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
    rqggyedtagsdvvvitagiqtridlagdnapimediqssldehnddyislttsnpvdll
    nrhlyeagdrsreqvigfggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfsk
    vrvdgtdpefsgdekeqllgdlqesamdvierkgatewgpargvahmveailhdtgevlp
    asvklegefghedtafgvpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis