PDB entry 2j5c

View 2j5c on RCSB PDB site
Description: rational conversion of substrate and product specificity in a monoterpene synthase. structural insights into the molecular basis of rapid evolution.
Class: lyase
Keywords: terpene synthases, 1, 8-cineole, monoterpene, lyase
Deposited on 2006-09-14, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,8-cineole synthase
    Species: SALVIA FRUTICOSA [TaxId:268906]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5C (Start-568)
    Domains in SCOPe 2.06: d2j5ca1, d2j5ca2
  • Chain 'B':
    Compound: 1,8-cineole synthase
    Species: SALVIA FRUTICOSA [TaxId:268906]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5C (Start-568)
    Domains in SCOPe 2.06: d2j5cb1, d2j5cb2
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5cA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrwirtggyqptlwdfstiqsfdseykee
    khlmraagmidqvkmmlqeevdsirrleliddlrrlgischfereiveilnskyytnnei
    derdlystalrfrllrqydfsvsqevfdcfknakgtdfkpslvddtrgllqlyeasflsa
    qgeetlrlardfatkflqkrvlvdkdinllssieralelpthwrvqmpnarsfidaykrr
    pdmnptvlelakldfnmvqaqfqqelkeasrwwnstglvhelpfvrdrivecyywttgvv
    errqhgyerimltkinalvttiddvfdiygtleelqlfttaiqrwdiesmkqlppymqic
    ylalfnfvnemaydtlrdkgfdstpylrkvwvgliesylieakwyykghkpsleeymkns
    wisiggipilshlffrltdsieeeaaesmhkyhdivrasctilrladdmgtsldevergd
    vpksvqcymneknaseeearehvrslidqtwkmmnkemmtssfskyfvevsanlarmaqw
    iyqhesdgfgmqhslvnkmlrdllfhrye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5cA (A:)
    hlmraagmidqvkmmlqeevdsirrleliddlrrlgischfereiveilnskyytnneid
    erdlystalrfrllrqydfsvsqevfdcfknakgtdfkpslvddtrgllqlyeasflsaq
    geetlrlardfatkflqkrvdinllssieralelpthwrvqmpnarsfidaykrrpdmnp
    tvlelakldfnmvqaqfqqelkeasrwwnstglvhelprdrivecyywttgvverrqhgy
    erimltkinalvttiddvfdiygtleelqlfttaiqrwdiesmkqlppymqicylalfnf
    vnemaydtlrdkgfdstpylrkvwvgliesylieakwyykghkpsleeymknswisiggi
    pilshlffrltdsieeeaaesmhkyhdivrasctilrladdmgtpksvqcyseeearehv
    rslidqtwkmmnkemmtssfskyfvevsanlarmaqwiyqhesdgfgqhslvnkmlrdll
    fhrye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j5cB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrwirtggyqptlwdfstiqsfdseykee
    khlmraagmidqvkmmlqeevdsirrleliddlrrlgischfereiveilnskyytnnei
    derdlystalrfrllrqydfsvsqevfdcfknakgtdfkpslvddtrgllqlyeasflsa
    qgeetlrlardfatkflqkrvlvdkdinllssieralelpthwrvqmpnarsfidaykrr
    pdmnptvlelakldfnmvqaqfqqelkeasrwwnstglvhelpfvrdrivecyywttgvv
    errqhgyerimltkinalvttiddvfdiygtleelqlfttaiqrwdiesmkqlppymqic
    ylalfnfvnemaydtlrdkgfdstpylrkvwvgliesylieakwyykghkpsleeymkns
    wisiggipilshlffrltdsieeeaaesmhkyhdivrasctilrladdmgtsldevergd
    vpksvqcymneknaseeearehvrslidqtwkmmnkemmtssfskyfvevsanlarmaqw
    iyqhesdgfgmqhslvnkmlrdllfhrye
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5cB (B:)
    raagmidqvkmmlqeevdsirrleliddlrrlgischfereiveilnskyytnneiderd
    lystalrfrllrqydfsvsqevfdcfknakgtdfkpslvddtrgllqlyeasflsaqgee
    tlrlardfatkflqkrvlvdinllssieralelpthwrvqmpnarsfidaykrrpdmnpt
    vlelakldfnmvqaqfqqelkeasrwwnstglvhelpfvrdrivecyywttgvverrqhg
    yerimltkinalvttiddvfdiygtleelqlfttaiqrwdiesmkqlppymqicylalfn
    fvnemaydtlrdkgfdstpylrkvwvgliesylieakwyykghkpsleeymknswisigg
    ipilshlffrltdsieeeaaesmhkyhdivrasctilrladdmgvpksvqcymneknase
    eearehvrslidqtwkmmnkemmtssfskyfvevsanlarmaqwiyqhesdgfqhslvnk
    mlrdllfhrye