PDB entry 2j52

View 2j52 on RCSB PDB site
Description: solution structure of gb1 domain protein g and low and high pressure.
Class: immunoglobulin
Keywords: peptidoglycan-anchor, immunoglobulin, pressure, cell wall, protein g, igg-binding protein
Deposited on 2006-09-11, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin G-binding protein G
    Species: Streptococcus sp. [TaxId:1306]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J52 (0-0)
      • engineered mutation (46)
    • Uniprot P06654 (1-55)
    Domains in SCOPe 2.06: d2j52a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2j52A (A:)
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtydaatktftvte