PDB entry 2j50

View 2j50 on RCSB PDB site
Description: structure of aurora-2 in complex with pha-739358
Class: transferase
Keywords: transferase, phosphorylation, nucleotide-binding, kinase, cell cycle, ATP-binding, nucleotide- binding, serine/threonine-protein kinase, serine-threonine-protein kinase
Deposited on 2006-09-08, released 2006-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2j50a1
  • Chain 'B':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2j50b1
  • Heterogens: 627, SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j50A (A:)
    gprqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j50A (A:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsagelkiadfgwsvtlcgtldylppemiedekvdlwslgvlc
    yeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevle
    hpwitanssk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j50B (B:)
    gprqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreve
    iqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelana
    lsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemieg
    rmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrl
    lkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j50B (B:)
    waledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqsh
    lrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsyc
    hskrvihrdikpenlllgsagelkiadfgwsvtlcgtldylppemiedekvdlwslgvlc
    yeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevle
    hpwitanssk