PDB entry 2j4u

View 2j4u on RCSB PDB site
Description: E.coli OmpC - camel Lactoferrin complex
Class: membrane protein/hydrolase
Keywords: membrane protein/hydrolase, membrane protein-hydrolase complex, iron, ompc, porin, complex, protease, hydrolase, membrane protein, antiacterial peptide, ion transport, iron transport, serine protease, transport, lactoferrin, glycoprotein, metal-binding
Deposited on 2006-09-06, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.218
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: outer membrane protein c precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4up_
  • Chain 'Q':
    Compound: outer membrane protein c precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4uq_
  • Chain 'R':
    Compound: outer membrane protein c precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4ur_
  • Chain 'S':
    Compound: lactotransferrin
    Species: CAMELUS DROMEDARIUS [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TUM0 (0-44)
      • conflict (16)
  • Chain 'U':
    Compound: outer membrane protein c precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4uu_
  • Chain 'V':
    Compound: outer membrane protein c precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4uv_
  • Chain 'W':
    Compound: outer membrane protein c precursor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4uw_
  • Chain 'X':
    Compound: lactotransferrin
    Species: CAMELUS DROMEDARIUS [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TUM0 (0-44)
      • conflict (16)

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2j4uP (P:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
    ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
    tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
    gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4uP (P:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdggsitydye
    gfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgs
    lgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnkn
    mstyvdykinllddnqftrdagintdnivalglvyqf
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2j4uQ (Q:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
    ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
    tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
    gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4uQ (Q:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdggsitydye
    gfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgs
    lgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnkn
    mstyvdykinllddnqftrdagintdnivalglvyqf
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2j4uR (R:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
    ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
    tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
    gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4uR (R:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdggsitydye
    gfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgs
    lgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnkn
    mstyvdykinllddnqftrdagintdnivalglvyqf
    

  • Chain 'S':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2j4uU (U:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
    ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
    tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
    gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4uU (U:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdggsitydye
    gfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgs
    lgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnkn
    mstyvdykinllddnqftrdagintdnivalglvyqf
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2j4uV (V:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
    ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
    tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
    gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4uV (V:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdggsitydye
    gfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgs
    lgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnkn
    mstyvdykinllddnqftrdagintdnivalglvyqf
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2j4uW (W:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdalrqngdgv
    ggsitydyegfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytq
    tynatrvgslgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdv
    gatyyfnknmstyvdykinllddnqftrdagintdnivalglvyqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4uW (W:)
    aevynkdgnkldlygkvdglhyfsdnkdvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnsaenennswtrvafaglkfqdvgsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgkngnpsgegftsgvtnngrdggsitydye
    gfgiggaissskrtdaqntaayigngdraetytgglkydanniylaaqytqtynatrvgs
    lgwankaqnfeavaqyqfdfglrpslaylqskgknlgrgyddedilkyvdvgatyyfnkn
    mstyvdykinllddnqftrdagintdnivalglvyqf
    

  • Chain 'X':
    No sequence available.