PDB entry 2j4k

View 2j4k on RCSB PDB site
Description: crystal structure of uridylate kinase from sulfolobus solfataricus in complex with ump to 2.2 angstrom resolution
Class: transferase
Keywords: aspartokinase family, pyrimidine biosynthesis, kinase, ump kinase, transferase, nucleoside monophosphate kinase, pyrimidine nucleotide synthesis
Deposited on 2006-09-01, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.1799
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4ka_
  • Chain 'B':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4kb_
  • Chain 'C':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4kc_
  • Chain 'D':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4kd_
  • Chain 'E':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4ke_
  • Chain 'F':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4kf_
  • Heterogens: U5P, CD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4kA (A:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4kA (A:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkillldplaikiv
    erskirvivmnyrklnrievssiiepv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j4kB (B:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4kB (B:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkielldplaikiv
    erskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j4kC (C:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4kC (C:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyiphlttqdlrlldplaikiverskirvi
    vmnyrklnriidilkgeevssiiepv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j4kD (D:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j4kE (E:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4kE (E:)
    mniilkisgkffdednvlrqsikeladngfrvgivtgggstarryiklareigigeayld
    llgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqstaavaal
    vaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagtyelld
    plaikiverskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j4kF (F:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4kF (F:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvykliphlttqdlrkiagtyelldplaikiverskir
    vivmnyrklnriidilkgeevssiiepv