PDB entry 2j4j

View 2j4j on RCSB PDB site
Description: crystal structure of uridylate kinase from sulfolobus solfataricus in complex with ump and amppcp to 2.1 angstrom resolution
Class: transferase
Keywords: transferase, nucleoside monophosphate kinase, kinase, ump kinase, aspartokinase fold, pyrimidine nucleotide synthesis, pyrimidine biosynthesis
Deposited on 2006-09-01, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4ja_
  • Chain 'B':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4jb_
  • Chain 'C':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4jc_
  • Chain 'D':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4jd_
  • Chain 'E':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4je_
  • Chain 'F':
    Compound: uridylate kinase
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4jf_
  • Heterogens: U5P, ACP, CO, MG, 4TC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4jA (A:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4jA (A:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkileelldplaik
    iverskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j4jB (B:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4jB (B:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkileelldplaik
    iverskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j4jC (C:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4jC (C:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilelldplaiki
    verskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j4jD (D:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4jD (D:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkileelldplaik
    iverskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j4jE (E:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4jE (E:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkileelldplaik
    iverskirvivmnyrklnriidilkgeevssiiepv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j4jF (F:)
    mniilkisgkffdednvdnlivlrqsikeladngfrvgivtgggstarryiklareigig
    eayldllgiwasrlnaylvmfslqdlaymhvpqsleefiqdwshgkvvvtggfqpgqsta
    avaalvaeasssktlvvatnvdgvyekdpriyadvkliphlttqdlrkilegsqsvqagt
    yelldplaikiverskirvivmnyrklnriidilkgeevssiiepv