PDB entry 2j4a

View 2j4a on RCSB PDB site
Description: human thyroid hormone receptor beta ligand binding domain in complex with kb131084
Class: receptor
Keywords: nuclear protein, disease mutation, nuclear receptor, zinc, receptor, deafness, zinc-finger, DNA-binding, transcription regulation, transcription, alternative splicing, ligand binding domain, polymorphism, metal-binding
Deposited on 2006-08-28, released 2007-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2297
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thyroid hormone receptor Beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10828 (Start-252)
      • engineered mutation (122)
    Domains in SCOPe 2.06: d2j4aa_
  • Heterogens: OEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4aA (A:)
    ghkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdlea
    fshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetl
    tlsgemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglac
    veriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecpt
    elfpplflevfed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4aA (A:)
    kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
    hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
    sgemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
    riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
    fpplflevfed