PDB entry 2j44

View 2j44 on RCSB PDB site
Description: alpha-glucan binding by a streptococcal virulence factor
Class: carbohydrate-binding module
Keywords: virulence, pullulanase, glycogen binding, streptococcus pneumoniae, carbohydrate-binding module
Deposited on 2006-08-24, released 2006-12-11
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-29, with a file datestamp of 2008-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22464
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline amylopullulanase
    Species: Streptococcus pneumoniae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j44a1, d2j44a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j44A (A:)
    dnyfrihvkklpeenkdaqglwtwddvekpsenwpngalsfkdakkddygyyldvklkge
    qakkisflinntagknltgdksveklvpkmneawldqdykvfsyepqpagtvrvnyyrtd
    gnydkkslwywgdvknpssaqwpdgtdftatgkygryidiplneaarefgfllldeskgd
    vkirkenykftdlknhsqiflkdddesiytnpyyvhd