PDB entry 2j44

View 2j44 on RCSB PDB site
Description: Alpha-glucan binding by a streptococcal virulence factor
Class: carbohydrate-binding module
Keywords: virulence, pullulanase, glycogen binding, streptococcus pneumoniae, carbohydrate-binding module
Deposited on 2006-08-24, released 2006-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alkaline amylopullulanase
  Species: Streptococcus pneumoniae [TaxId:1313]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q97SQ7 (179-216)
  Domains in SCOPe 2.08: d2j44a1, d2j44a2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j44A (A:)
  dnyfrihvkklpeenkdaqglwtwddvekpsenwpngalsfkdakkddygyyldvklkge
  qakkisflinntagknltgdksveklvpkmneawldqdykvfsyepqpagtvrvnyyrtd
  gnydkkslwywgdvknpssaqwpdgtdftatgkygryidiplneaarefgfllldeskgd
  vkirkenykftdlknhsqiflkdddesiytnpyyvhd