PDB entry 2j43

View 2j43 on RCSB PDB site
Description: alpha-glucan recognition by family 41 carbohydrate-binding modules from streptococcal virulence factors
Class: carbohydrate-binding module
Keywords: family 41, pullulanase, streptococcal, carbohydrate-binding module, glycogen binding, glycoside hydrolase
Deposited on 2006-08-24, released 2006-12-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.181
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spydx
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XX8 (1-End)
      • conflict (1)
      • conflict (110)
      • conflict (2)
      • conflict (111)
    Domains in SCOPe 2.06: d2j43a1, d2j43a2
  • Chain 'B':
    Compound: spydx
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99XX8 (Start-218)
      • conflict (109)
      • conflict (1)
      • conflict (110)
    Domains in SCOPe 2.06: d2j43b1, d2j43b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j43A (A:)
    ashhlrmhfktlpageslgslglwvwgdvdqpskdwpngaitmtkakkddygyyldvpla
    akhrqqvsylinnkagenlskdqhislltpkmnevwidenyhahayrplkegylrinyhn
    qsghydnlavwtfkdvktpttdwpngldlshkghygayvdvplkeganeigflildkskt
    gdaikvqpkdylfkeldnhtqvfvkdtdpkvynnpyyid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j43B (B:)
    ashhlrmhfktlpageslgslglwvwgdvdqpskdwpngaitmtkakkddygyyldvpla
    akhrqqvsylinnkagenlskdqhislltpkmnevwidenyhahayrplkegylrinyhn
    qsghydnlavwtfkdvktpttdwpngldlshkghygayvdvplkeganeigflildkskt
    gdaikvqpkdylfkeldnhtqvfvkdtdpkvynnpyyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j43B (B:)
    shhlrmhfktlpageslgslglwvwgdvdqpskdwpngaitmtkakkddygyyldvplaa
    khrqqvsylinnkagenlskdqhislltpkmnevwidenyhahayrplkegylrinyhnq
    sghydnlavwtfkdvktpttdwpngldlshkghygayvdvplkeganeigflildksktg
    daikvqpkdylfkeldnhtqvfvkdtdpkvynnpyyid