PDB entry 2j1u

View 2j1u on RCSB PDB site
Description: structure of a streptococcus pneumoniae fucose binding module in complex with the blood group a-tetrasaccharide
Class: carbohydrate-binding protein
Keywords: sugar binding protein, carbohydrate-binding protein
Deposited on 2006-08-15, released 2006-09-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fucolectin-related protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2j1ua_
  • Chain 'B':
    Compound: fucolectin-related protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1U
    • Uniprot Q97N96 (Start-150)
    Domains in SCOPe 2.04: d2j1ub_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j1uA (A:)
    gshmastpdkfndgnlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnp
    swwevdlkkmdkvglvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsld
    fkekgaryikvklltsgvplslaevevfres
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1uA (A:)
    kfndgnlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkk
    mdkvglvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryi
    kvklltsgvplslaevevfre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j1uB (B:)
    gshmastpdkfndgnlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnp
    swwevdlkkmdkvglvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsld
    fkekgaryikvklltsgvplslaevevfres
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1uB (B:)
    nlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkvg
    lvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkll
    tsgvplslaevevfres