PDB entry 2j1p

View 2j1p on RCSB PDB site
Description: geranylgeranyl diphosphate synthase from sinapis alba in complex with ggpp
Class: transferase
Keywords: transferase, isoprene biosynthesis, multifunctional enzyme, carotenoid biosynthesis, isoprenyl transtransferase, isoprenoid diphosphate synthase, transit peptide, chloroplast, geranylgeranyl diphosphate
Deposited on 2006-08-15, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: SINAPIS ALBA [TaxId:3728]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1P (Start-13)
      • conflict (77)
    • Uniprot Q43133 (242-292)
    Domains in SCOPe 2.07: d2j1pa_
  • Chain 'B':
    Compound: Geranylgeranyl pyrophosphate synthetase
    Species: SINAPIS ALBA [TaxId:3728]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1P (Start-13)
      • conflict (77)
    • Uniprot Q43133 (242-End)
    Domains in SCOPe 2.07: d2j1pb_
  • Heterogens: GRG, PGO, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j1pA (A:)
    mmrgshhhhhtdpisyiirkadsvnkaldsavplreplkiheamrysllaggkrvrpvlc
    iaacelvggeeslampaacavemihtmslihddlpcmdnddlrrgkptnhkvygedvavl
    agdallsfafehlasatssevsparvvravgelakaigteglvagqvvdissegldlnnv
    glehlkfihlhktaalleasavlggiigggsdeeierlrkfarcigllfqvvddildvtk
    sskltypklmgleksrefaeklnteardqllgfdsdkvapllalanyianrqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1pA (A:)
    pisyiirkadsvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvggees
    lampaacavemihtmslihddlpcmdnddlrrgkptnhkvygedvavlagdallsfafeh
    lasatssevsparvvravgelakaigteglvagqvvdisldlnnvglehlkfihlhktaa
    lleasavlggiigggsdeeierlrkfarcigllfqvvddildvtkkltypklmgleksre
    faeklnteardqllgfdsdkvapllalanyianrqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j1pB (B:)
    mmrgshhhhhtdpisyiirkadsvnkaldsavplreplkiheamrysllaggkrvrpvlc
    iaacelvggeeslampaacavemihtmslihddlpcmdnddlrrgkptnhkvygedvavl
    agdallsfafehlasatssevsparvvravgelakaigteglvagqvvdissegldlnnv
    glehlkfihlhktaalleasavlggiigggsdeeierlrkfarcigllfqvvddildvtk
    sskltypklmgleksrefaeklnteardqllgfdsdkvapllalanyianrqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1pB (B:)
    dpisyiirkadsvnkaldsavplreplkiheamrysllaggkrvrpvlciaacelvggee
    slampaacavemihtmslihddlpcmdnddlrrgkptnhkvygedvavlagdallsfafe
    hlasatssevsparvvravgelakaigteglvagqvvdissegldlnnvglehlkfihlh
    ktaalleasavlggiigggsdeeierlrkfarcigllfqvvddildvtksskltypklmg
    leksrefaeklnteardqllgfdsdkvapllalanyi