PDB entry 2j1k

View 2j1k on RCSB PDB site
Description: cav-2 fibre head in complex with car d1
Class: virus/receptor
Keywords: virus-receptor complex, complex, membrane, receptor, palmitate, domain d1, immunoglobulin domain, host-virus interaction, glycoprotein, fiber protein, cell adhesion, phosphorylation, transmembrane, tight junction, coxsackievirus, fiber head, adenovirus, fibre head, lipoprotein, car, knob, fiber, fibre, cav-2, canine
Deposited on 2006-08-14, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1ka_
  • Chain 'B':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kb_
  • Chain 'C':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kc1
  • Chain 'D':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kd_
  • Chain 'E':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1ke_
  • Chain 'F':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kf_
  • Chain 'G':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kg_
  • Chain 'H':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kh_
  • Chain 'I':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1ki_
  • Chain 'J':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kj_
  • Chain 'K':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kk_
  • Chain 'L':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kl_
  • Chain 'M':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1km_
  • Chain 'N':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kn_
  • Chain 'O':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1ko_
  • Chain 'P':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kp_
  • Chain 'Q':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kq_
  • Chain 'R':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1kr_
  • Chain 'S':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1K
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.07: d2j1ks_
  • Chain 'T':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kt_
  • Chain 'V':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kv_
  • Chain 'X':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kx_
  • Chain 'Y':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1ky_
  • Chain 'Z':
    Compound: coxsackievirus and adenovirus receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j1kz_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j1kA (A:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kA (A:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j1kB (B:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kB (B:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispakvdqviilysgdki
    yddyypdlkgrvhftsndlksgdasinvdigtyqckvkkapgvankkihlvvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j1kC (C:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kC (C:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j1kD (D:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kD (D:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j1kE (E:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kE (E:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j1kF (F:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kF (F:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2j1kG (G:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kG (G:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j1kH (H:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kH (H:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2j1kI (I:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kI (I:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2j1kJ (J:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kJ (J:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2j1kK (K:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kK (K:)
    farslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilys
    gdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl
    vvl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2j1kL (L:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kL (L:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2j1kM (M:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kM (M:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2j1kN (N:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kN (N:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2j1kO (O:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kO (O:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadvdqviilysgdkiyd
    dyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2j1kP (P:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kP (P:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2j1kQ (Q:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kQ (Q:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2j1kR (R:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kR (R:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2j1kS (S:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kS (S:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2j1kT (T:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kT (T:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2j1kV (V:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kV (V:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    v
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2j1kX (X:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kX (X:)
    arslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysg
    dkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlv
    vlv
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2j1kY (Y:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kY (Y:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvv
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2j1kZ (Z:)
    madfarslsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqvii
    lysgdkiyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankk
    ihlvvlvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1kZ (Z:)
    slsittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdk
    iyddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihl