PDB entry 2j14

View 2j14 on RCSB PDB site
Description: 3,4,5-trisubstituted isoxazoles as novel ppardelta agonists: part2
Class: transcription
Keywords: transcription, nuclear receptor fold, transcription regulation, ppar, zinc, receptor, activator, fatty acids, nuclear protein, alternative splicing, zinc-finger, DNA-binding, metal-binding
Deposited on 2006-08-08, released 2006-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j14a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j14b_
  • Heterogens: GNI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j14A (A:)
    mghhhhhhgsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdi
    etlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslfln
    dqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefav
    kfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylf
    pkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j14A (A:)
    dlkafskhiynaylknfnmtkkkarsiltshtapfvihdietlwqaeklppykeisvhvf
    yrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllva
    ngsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmn
    vprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikktete
    tslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j14B (B:)
    mghhhhhhgsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdi
    etlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslfln
    dqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefav
    kfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylf
    pkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j14B (B:)
    lkafskhiynaylknfnmtkkkarsiltgkpfvihdietlwqaekgllppykeisvhvfy
    rcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvan
    gsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnv
    prveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikktetet
    slhpllqeiykd