PDB entry 2j05

View 2j05 on RCSB PDB site
Description: crystal structure of the rasgap sh3 domain at 1.5 angstrom resolution
Class: signal transduction
Keywords: gtpase activation, sh3 domain, sh2 domain, src homology 3, ras signaling pathway, gtpase activating protein, proto-oncogene, phosphorylation, disease mutation, signal transduction
Deposited on 2006-08-01, released 2007-01-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J05 (Start-3)
    • Uniprot P20936 (4-64)
    Domains in SCOPe 2.05: d2j05a_
  • Chain 'B':
    Compound: Ras GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J05
    • Uniprot P20936 (4-End)
    Domains in SCOPe 2.05: d2j05b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j05A (A:)
    gshmrrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlv
    eevgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j05A (A:)
    shmrrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlve
    evgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j05B (B:)
    gshmrrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlv
    eevgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j05B (B:)
    rrrvrailpytkvpdtdeisflkgdmfivhneledgwmwvtnlrtdeqglivedlveevg