PDB entry 2j03

View 2j03 on RCSB PDB site
Description: structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). this file contains the 50s subunit from molecule II.
Class: ribosome
Keywords: ribosome, tRNA, paromomycin, mRNA, translation
Deposited on 2006-07-31, released 2006-09-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.272
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
    • PDB 2J03 (0-0)
    • Uniprot P60493 (1-84)
  • Chain '1':
    Compound: 50S ribosomal protein L28
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j0321
  • Chain '3':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain '8':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus
  • Chain 'C':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j03c1
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j03i1, d2j03i2
  • Chain 'N':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j03o1
  • Chain 'P':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: 50s ribosomal protein l7
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: 50S ribosomal protein L25
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LYS

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    No sequence available.

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2j032 (2:)
    mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
    ltvlnekrrqna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j032 (2:)
    earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt
    

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain '8':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j03C (C:)
    mpkhgkryrallekvdpnkvytideaarlvkelatakfdetvevhaklgidprrsdqnvr
    gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
    mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
    fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03C (C:)
    kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
    keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
    reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
    vtttmgpsvri
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2j03I (I:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvvaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j03I (I:)
    mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
    rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
    kelgeyvltykphpevpiqlkvsvvv
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j03O (O:)
    miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
    vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
    vl
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.