PDB entry 2izy

View 2izy on RCSB PDB site
Description: molecular basis of akap specificity for pka regulatory subunits
Class: transferase
Keywords: d/d, rii, pka, camp, kinase, acetylation, transferase, camp- binding, phosphorylation, nucleotide-binding
Deposited on 2006-07-27, released 2006-11-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izya_
  • Chain 'B':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izyb_
  • Chain 'C':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izyc_
  • Chain 'D':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izyd_
  • Chain 'E':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izye_
  • Chain 'F':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izyf_
  • Chain 'G':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izyg_
  • Chain 'H':
    Compound: camp-dependent protein kinase regulatory subunit II
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZY (45-End)
    • Uniprot P12368 (Start-44)
    Domains in SCOPe 2.01: d2izyh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2izyA (A:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyA (A:)
    qippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2izyB (B:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyB (B:)
    iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrgleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2izyC (C:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyC (C:)
    qippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2izyD (D:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyD (D:)
    iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2izyE (E:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyE (E:)
    iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2izyF (F:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyF (F:)
    iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2izyG (G:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyG (G:)
    qippgltellqgytvevlrqqppdlvdfaveyftrlrearrgleh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2izyH (H:)
    mghiqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izyH (H:)
    iqippgltellqgytvevlrqqppdlvdfaveyftrlrearrglehh