PDB entry 2izw

View 2izw on RCSB PDB site
Description: crystal structure of ryegrass mottle virus
Class: virus
Keywords: RNA, virus, assembly, capsid protein
Deposited on 2006-07-27, released 2007-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.294
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ryegrass mottle virus coat protein
    Species: RYEGRASS MOTTLE VIRUS [TaxId:119910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2izwa_
  • Chain 'B':
    Compound: ryegrass mottle virus coat protein
    Species: RYEGRASS MOTTLE VIRUS [TaxId:119910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2izwb_
  • Chain 'C':
    Compound: ryegrass mottle virus coat protein
    Species: RYEGRASS MOTTLE VIRUS [TaxId:119910]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2izwc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2izwA (A:)
    arkkgksasqvivlkeksrkkrqksrgqqptrqvtpvsapaamgtqityrgpqvvtqygd
    itpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvryahftwe
    pivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpehaslpw
    ylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izwA (A:)
    qygditpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvryah
    ftwepivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpeha
    slpwylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2izwB (B:)
    arkkgksasqvivlkeksrkkrqksrgqqptrqvtpvsapaamgtqityrgpqvvtqygd
    itpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvryahftwe
    pivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpehaslpw
    ylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izwB (B:)
    tqygditpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvrya
    hftwepivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpeh
    aslpwylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2izwC (C:)
    arkkgksasqvivlkeksrkkrqksrgqqptrqvtpvsapaamgtqityrgpqvvtqygd
    itpaknsgslvrvtssatagtevsgtvlfnvrnatelpwlsgqgsryskyrvryahftwe
    pivgsntngevamamlydvadvtsitierlmqtrggtwgpiwsptrkrlsydpehaslpw
    ylsgvssgaaagniqtpfqiawaaqsslvsttlgrimaeylveltdpvdvtinq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izwC (C:)
    gqqptrqvtpvsapaamgtqityrgpqvvtqygditpaknsgslvrvtssatagtevsgt
    vlfnvrnatelpwlsgqgsryskyrvryahftwepivgsntngevamamlydvadvtsit
    ierlmqtrggtwgpiwsptrkrlsydpehaslpwylsgvssgaaagniqtpfqiawaaqs
    slvsttlgrimaeylveltdpvdvtinq