PDB entry 2izv

View 2izv on RCSB PDB site
Description: crystal structure of socs-4 in complex with elongin-b and elongin-c at 2.55a resolution
Class: transcription
Keywords: signal transduction inhibitor, growth regulation, signal transduction, sh2 domain, transcription, nuclear protein, ubl conjugation pathway, transcription regulation
Deposited on 2006-07-26, released 2006-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.175
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: suppressor of cytokine signaling 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZV (Start-22)
    • Uniprot Q8WXH5 (23-End)
    Domains in SCOPe 2.07: d2izva1, d2izva2, d2izva3
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2izvb_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZV
    • Uniprot Q15369 (1-96)
    Domains in SCOPe 2.07: d2izvc_
  • Heterogens: NA, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2izvA (A:)
    mhhhhhhssgvdlgtenlyfqsmlvpdllqinnnpcywgvmdkyaaeallegkpegtfll
    rdsaqedylfsvsfrrysrslharieqwnhnfsfdahdpcvfhspditgllehykdpsac
    mffepllstplirtfpfslqhicrtvicncttydgidalpipssmklylkeyhykskvrv
    lridape
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izvA (A:)
    nlyfqsmlvpdllqinnnpcywgvmdkyaaeallegkpegtfllrdsaqedylfsvsfrr
    ysrslharieqwnhnfsfdahdpcvfhspditgllehykdpsacmffepllstplirtfp
    fslqhicrtvicncttydgidalpipssmklylkeyhykskvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2izvB (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izvB (B:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2izvC (C:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izvC (C:)
    myvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnss
    teipefpiapeialellmaanfldc