PDB entry 2izb

View 2izb on RCSB PDB site
Description: apostreptavidin ph 3.12 i4122 structure
Deposited on 1997-08-13, released 1998-09-16
The last revision prior to the SCOP 1.59 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.207
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2izb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2izb_ (-)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vk