PDB entry 2iz2

View 2iz2 on RCSB PDB site
Description: crystal structure of the ligand binding domain of fushi tarazu factor 1 from drosophila melanogaster
Class: DNA binding protein
Keywords: nuclear protein, phosphorylation, fushi tarazu factor 1, transcription regulation, nr5a3, ftzf1, receptor, homeobox, activator, developmental protein, zinc-finger, DNA-binding, transcription, metal-binding, DNA binding protein
Deposited on 2006-07-24, released 2007-10-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.256
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nuclear hormone receptor ftz-f1
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • PDB 2IZ2 (0-7)
  • Uniprot P33244 (8-242)
  Domains in SCOPe 2.08: d2iz2a1, d2iz2a2
• Chain 'B':
  Compound: segmentation protein fushi tarazu
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02835 (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2iz2A (A:)
  gshmledplrvspmirefvqsiddrewqtqlfallqkqtynqvevdlfelmckvldqnlf
  sqvdwarntvffkdlkvddqmkllqhswsdmlvldhlhhrihnglpdetqlnngqvfnlm
  slgllgvpqlgdyfnelqnklqdlkfdmgdyvcmkflillnpsvrgivnrktvseghdnv
  qaalldytltcypsvndkfrglvnilpeihamavrgedhlytkhcagsaptqtllmemlh
  akr
  

  
  
• Chain 'B':
  No sequence available.