PDB entry 2iyn

View 2iyn on RCSB PDB site
Description: the co-factor-induced pre-active conformation in phob
Class: transcription
Keywords: transcription, transcription factor, phosphate transport, activator, sensory transduction, phosphate regulation, two-component regulatory system, alpha/beta doubly-wound fold
Deposited on 2006-07-19, released 2006-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.233
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iyna_
  • Chain 'B':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iynb_
  • Chain 'C':
    Compound: phosphate regulon transcriptional regulatory protein phob
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iync_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iynA (A:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrispma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iynA (A:)
    rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
    qfikhlkresmtrdipvvmltargetgaddyitkpfspkelvarikavmr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iynB (B:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrispma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iynB (B:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rris
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iynC (C:)
    marrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggs
    giqfikhlkresmtrdipvvmltargeeedrvrgletgaddyitkpfspkelvarikavm
    rrispma
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iynC (C:)
    rrilvvedeapiremvcfvleqngfqpveaedydsavnqlnepwpdlilldwmlpggsgi
    qfikhlkresmtrdipvvmltatgaddyitkpfspkelvarikavmrr