PDB entry 2iy4

View 2iy4 on RCSB PDB site
Description: x-ray structure of dps from listeria monocytogenes
Class: metal-binding protein
Keywords: iron, iron storage, metal-binding, oxidative damage, dpslm (DNA-binding protein from starved cells) from lister iron-incorporation, metal-binding protein
Deposited on 2006-07-12, released 2007-01-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.185
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4a_
  • Chain 'B':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4b_
  • Chain 'C':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4c_
  • Chain 'D':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4d_
  • Chain 'E':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4e_
  • Chain 'F':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4f_
  • Chain 'G':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4g_
  • Chain 'H':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4h_
  • Chain 'I':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4i_
  • Chain 'J':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4j_
  • Chain 'K':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4k_
  • Chain 'L':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4l_
  • Chain 'M':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4m_
  • Chain 'N':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4n_
  • Chain 'O':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4o_
  • Chain 'P':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4p_
  • Chain 'Q':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4q_
  • Chain 'R':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4r_
  • Chain 'S':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4s_
  • Chain 'T':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4t_
  • Chain 'U':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4u_
  • Chain 'V':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4v_
  • Chain 'X':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4x_
  • Chain 'Y':
    Compound: non-heme iron-containing ferritin
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iy4y_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iy4A (A:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4A (A:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iy4B (B:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4B (B:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iy4C (C:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4C (C:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iy4D (D:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4D (D:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2iy4E (E:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4E (E:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2iy4F (F:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4F (F:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2iy4G (G:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4G (G:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2iy4H (H:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4H (H:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2iy4I (I:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4I (I:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2iy4J (J:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4J (J:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2iy4K (K:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4K (K:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2iy4L (L:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4L (L:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2iy4M (M:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4M (M:)
    dtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerllai
    ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdnv
    tndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2iy4N (N:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4N (N:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2iy4O (O:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4O (O:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2iy4P (P:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4P (P:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2iy4Q (Q:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4Q (Q:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2iy4R (R:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4R (R:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2iy4S (S:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4S (S:)
    svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
    aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
    nvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2iy4T (T:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4T (T:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2iy4U (U:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4U (U:)
    tinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevae
    rllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdk
    egdnvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2iy4V (V:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4V (V:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2iy4X (X:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4X (X:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2iy4Y (Y:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgielt
    dkegdnvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iy4Y (Y:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegdn
    vtndmliafkasidkhiwmfkaflgkaple