PDB entry 2iy1

View 2iy1 on RCSB PDB site
Description: senp1 (mutant) full length sumo1
Class: hydrolase/nuclear protein complex
Keywords: nuclear protein, ubl conjugation pathway, protease, hydrolase, ubiquitin, thiol protease, protein protein complex, hydrolase/nuclear protein complex
Deposited on 2006-07-11, released 2006-08-15
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.25081
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (175-225)
      • engineered mutation (184)
    • PDB 2IY1
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2iy1b1
  • Chain 'C':
    Compound: sentrin-specific protease 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P0U3 (175-225)
      • engineered mutation (184)
    • PDB 2IY1
  • Chain 'D':
    Compound: Small ubiquitin-related modifier 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2iy1d1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iy1B (B:)
    eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
    lgmeeedvievyqeqtgghstvc
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iy1D (D:)
    eyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpke
    lgmeeedvievyqeqtgghstvc