PDB entry 2ixx

View 2ixx on RCSB PDB site
Description: structural basis for ompc mediated antibiotic resistance in clinical isolates of escherichia coli.
Class: membrane protein
Keywords: ompc porin, antibiotic resistance, beta barrel, membrane protein
Deposited on 2006-07-11, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein C
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixxa_
  • Chain 'B':
    Compound: Outer membrane protein C
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ixxb_
  • Heterogens: MHA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ixxA (A:)
    aevynkdgnkldlygkvdglhyfsddksvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnapesennswtrvafaglkfqdigsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgqngsvsgendpdftghgitnngrkalrqn
    gdgvggsitydyegfgvgaavssskrtwdqnntgligtgdraetytgglkydanniylaa
    qytqtynatrvgslgwankaqnfeavaqyqfdfglrpsvaylqskgknlgvvagrnydde
    dilkyvdvgatyyfnknmstyvdykinllddnqftraagintddivalglvyqf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ixxB (B:)
    aevynkdgnkldlygkvdglhyfsddksvdgdqtymrlgfkgetqvtdqltgygqweyqi
    qgnapesennswtrvafaglkfqdigsfdygrnygvvydvtswtdvlpefggdtygsdnf
    mqqrgngfatyrntdffglvdglnfavqyqgqngsvsgendpdftghgitnngrkalrqn
    gdgvggsitydyegfgvgaavssskrtwdqnntgligtgdraetytgglkydanniylaa
    qytqtynatrvgslgwankaqnfeavaqyqfdfglrpsvaylqskgknlgvvagrnydde
    dilkyvdvgatyyfnknmstyvdykinllddnqftraagintddivalglvyqf