PDB entry 2iwt

View 2iwt on RCSB PDB site
Description: thioredoxin h2 (hvtrxh2) in a mixed disulfide complex with the target protein basi
Class: oxidoreductase
Keywords: protease inhibitor, disulfide reductase, basi, amy2, redox, thioredoxin, oxidoreductase, substrate recognition, disulfide intermediate, alpha-amylase inhibitor, serine protease inhibitor
Deposited on 2006-07-04, released 2006-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin h isoform 2
    Species: Hordeum vulgare [TaxId:4513]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IWT
      • engineered mutation (51)
    • Uniprot Q7XZK2
    Domains in SCOPe 2.06: d2iwta_
  • Chain 'B':
    Compound: Alpha-amylase/subtilisin inhibitor
    Species: Hordeum vulgare [TaxId:4513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2iwtb_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iwtA (A:)
    gshmaasataaavaaevisvhsleqwtmqieeantakklvvidftaswcgpsrimapvfa
    dlakkfpnavflkvdvdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvgl
    haaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iwtA (A:)
    evisvhsleqwtmqieeantakklvvidftaswcgpsrimapvfadlakkfpnavflkvd
    vdelkpiaeqfsveamptflfmkegdvkdrvvgaikeeltakvglhaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iwtB (B:)
    mhhhhhhaadpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpn
    gqhdgfpvritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitg
    pvkdpspsgrenafriekysgaevheyklmssgdwcqdlgvfrdlkggawflgatepyhv
    vvfkkappa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iwtB (B:)
    aadpppvhdtdghelradanyyvlsanrahgggltmapghgrhcplfvsqdpngqhdgfp
    vritpygvapsdkiirlstdvrisfrayttclqstewhidselaagrrhvitgpvkdpsp
    sgrenafriekysgaevheyklmssgdwcqdlgvfrdlkggawflgatepyhvvvfkkap
    pa