PDB entry 2iwr

View 2iwr on RCSB PDB site
Description: gtpase like domain of centaurin gamma 1 (human)
Class: hydrolase
Keywords: ank repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport, gtpase activation, hydrolase, metal-binding, nuclear protein, phosphorylation, sgc, zinc, centg1, gtpase, oncogene, transport, structual genomics consortium, structural genomics consortium, structural genomics
Deposited on 2006-07-03, released 2006-07-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.152
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: centaurin gamma 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2IWR (0-1)
    • Uniprot Q99490 (2-End)
    Domains in SCOPe 2.05: d2iwra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iwrA (A:)
    smrsipelrlgvlgdarsgksslihrfltgsyqvlekteseqykkemlvdgqthlvlire
    eagapdakfsgwadavifvfsledensfqavsrlhgqlsslrgegrgglalalvgtqdri
    sassprvvgdararalcadmkrcsyyetcatyglnvdrvfqevaqkvvtlrkqqqlla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iwrA (A:)
    smrsipelrlgvlgdarsgksslihrfltgsyqvlekteseqykkemlvdgqthlvlire
    eagapdakfsgwadavifvfsledensfqavsrlhgqlsslrgegrgglalalvgtqdri
    sassprvvgdararalcadmkrcsyyetcatyglnvdrvfqevaqkvvtlrkqqql