PDB entry 2iwk

View 2iwk on RCSB PDB site
Description: inhibitor-bound form of nitrous oxide reductase from achromobacter cycloclastes at 1.7 angstrom resolution
Class: oxidoreductase
Keywords: metal-binding, oxidoreductase, denitrification, nitrous oxide binding, catalysis, periplasmic electron gating, copper chemistry, calcium, copper
Deposited on 2006-06-30, released 2006-08-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrous oxide reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94127
      • conflict (513)
    Domains in SCOPe 2.05: d2iwka1, d2iwka2
  • Chain 'B':
    Compound: nitrous oxide reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94127
      • conflict (513)
    Domains in SCOPe 2.05: d2iwkb1, d2iwkb2
  • Heterogens: CU, CUZ, IOD, CA, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iwkA (A:)
    meskehkglsrralfsatagsailagtvgpaalslgaaglatparaatgadgsvapgkld
    dyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirihqrtmtektkkq
    laangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvmktdaileipna
    kgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavdadkwevawqvkv
    sgnldncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeiekaikagqyeei
    ngvkvvdgrkeakslftryipiannphgcnmapdrkhlcvagklsptvtvldvtkfdalf
    ydnaeprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnideairayagekinp
    ikdkldvqyqpghlktvmgetldaandwlvclckfskdrflnvgplkpendqlidisgdk
    mvlvhdgptfaephdaiavspsilpnirsvwdrndplwaetrkqaeadevdidewteavi
    rdgnkvrvymtsvapsfsqpsftvkegdevtvivtnldeiddlthgftmgnhgvamevgp
    qqtssvtfvaanpgvywyycqwfchalhmemrgrmfvepkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iwkA (A:)
    adgsvapgklddyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirih
    qrtmtektkkqlaangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvm
    ktdaileipnakgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavda
    dkwevawqvkvsgnldncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeie
    kaikagqyeeingvkvvdgrkeakslftryipiannphgcnmapdrkhlcvagklsptvt
    vldvtkfdalfydnaeprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnidea
    irayagekinpikdkldvqyqpghlktvmgetldaandwlvclckfskdrflnvgplkpe
    ndqlidisgdkmvlvhdgptfaephdaiavspsilpnirsvwdrndplwaetrkqaeade
    vdidewteavirdgnkvrvymtsvapsfsqpsftvkegdevtvivtnldeiddlthgftm
    gnhgvamevgpqqtssvtfvaanpgvywyycqwfchalhmemrgrmfvep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iwkB (B:)
    meskehkglsrralfsatagsailagtvgpaalslgaaglatparaatgadgsvapgkld
    dyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirihqrtmtektkkq
    laangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvmktdaileipna
    kgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavdadkwevawqvkv
    sgnldncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeiekaikagqyeei
    ngvkvvdgrkeakslftryipiannphgcnmapdrkhlcvagklsptvtvldvtkfdalf
    ydnaeprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnideairayagekinp
    ikdkldvqyqpghlktvmgetldaandwlvclckfskdrflnvgplkpendqlidisgdk
    mvlvhdgptfaephdaiavspsilpnirsvwdrndplwaetrkqaeadevdidewteavi
    rdgnkvrvymtsvapsfsqpsftvkegdevtvivtnldeiddlthgftmgnhgvamevgp
    qqtssvtfvaanpgvywyycqwfchalhmemrgrmfvepkga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iwkB (B:)
    adgsvapgklddyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirih
    qrtmtektkkqlaangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvm
    ktdaileipnakgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavda
    dkwevawqvkvsgnldncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeie
    kaikagqyeeingvkvvdgrkeakslftryipiannphgcnmapdrkhlcvagklsptvt
    vldvtkfdalfydnaeprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnidea
    irayagekinpikdkldvqyqpghlktvmgetldaandwlvclckfskdrflnvgplkpe
    ndqlidisgdkmvlvhdgptfaephdaiavspsilpnirsvwdrndplwaetrkqaeade
    vdidewteavirdgnkvrvymtsvapsfsqpsftvkegdevtvivtnldeiddlthgftm
    gnhgvamevgpqqtssvtfvaanpgvywyycqwfchalhmemrgrmfvep