PDB entry 2iug

View 2iug on RCSB PDB site
Description: Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
Class: transferase
Keywords: transferase, polymorphism, ubl conjugation, phosphorylation, p85, sh2, pi3k, sh2 domain, sh3 domain, pi3-kinase, disease mutation
Deposited on 2006-06-03, released 2006-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-28, with a file datestamp of 2021-04-23.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase regulatory alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2iuga1, d2iuga2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2iugA (A:)
gmnnnmslqnaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnkl
ikifhrdgkygfsdpltfssvvelinhyrneslaqynpkldvkllypvskyqqdqvvked

    Sequence, based on observed residues (ATOM records): (download) 
    >2iugA (A:)
nnmslqnaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnkliki
fhrdgkygfsdpltfssvvelinhyrneslaqynpkldvkllypvskyqq